Anti UGT1A6 pAb (ATL-HPA054065 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054065-25
  • Immunohistochemistry analysis in human kidney and lymph node tissues using HPA054065 antibody. Corresponding UGT1A6 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UDP glucuronosyltransferase 1 family, polypeptide A6
Gene Name: UGT1A6
Alternative Gene Name: GNT1, HLUGP, UGT1F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090124: 63%, ENSRNOG00000018740: 73%
Entrez Gene ID: 54578
Uniprot ID: P19224
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY
Gene Sequence WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY
Gene ID - Mouse ENSMUSG00000090124
Gene ID - Rat ENSRNOG00000018740
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti UGT1A6 pAb (ATL-HPA054065 w/enhanced validation)
Datasheet Anti UGT1A6 pAb (ATL-HPA054065 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UGT1A6 pAb (ATL-HPA054065 w/enhanced validation)