Protein Description: ubiquitin fusion degradation 1 like (yeast)
Gene Name: UFD1L
Alternative Gene Name: UFD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005262: 100%, ENSRNOG00000047394: 100%
Entrez Gene ID: 7353
Uniprot ID: Q92890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UFD1L
Alternative Gene Name: UFD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005262: 100%, ENSRNOG00000047394: 100%
Entrez Gene ID: 7353
Uniprot ID: Q92890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR |
Documents & Links for Anti UFD1L pAb (ATL-HPA073425) | |
Datasheet | Anti UFD1L pAb (ATL-HPA073425) Datasheet (External Link) |
Vendor Page | Anti UFD1L pAb (ATL-HPA073425) at Atlas |
Documents & Links for Anti UFD1L pAb (ATL-HPA073425) | |
Datasheet | Anti UFD1L pAb (ATL-HPA073425) Datasheet (External Link) |
Vendor Page | Anti UFD1L pAb (ATL-HPA073425) |