Anti UFD1L pAb (ATL-HPA073425)

Atlas Antibodies

SKU:
ATL-HPA073425-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ubiquitin fusion degradation 1 like (yeast)
Gene Name: UFD1L
Alternative Gene Name: UFD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005262: 100%, ENSRNOG00000047394: 100%
Entrez Gene ID: 7353
Uniprot ID: Q92890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR
Gene Sequence MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR
Gene ID - Mouse ENSMUSG00000005262
Gene ID - Rat ENSRNOG00000047394
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UFD1L pAb (ATL-HPA073425)
Datasheet Anti UFD1L pAb (ATL-HPA073425) Datasheet (External Link)
Vendor Page Anti UFD1L pAb (ATL-HPA073425) at Atlas Antibodies

Documents & Links for Anti UFD1L pAb (ATL-HPA073425)
Datasheet Anti UFD1L pAb (ATL-HPA073425) Datasheet (External Link)
Vendor Page Anti UFD1L pAb (ATL-HPA073425)