Anti UCMA pAb (ATL-HPA046718)

Atlas Antibodies

SKU: ATL-HPA046718-25

• 

Protein Description: upper zone of growth plate and cartilage matrix associated
Gene Name: UCMA
Alternative Gene Name: C10orf49
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026668: 88%, ENSRNOG00000017987: 88%
Entrez Gene ID: 221044
Uniprot ID: Q8WVF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
• Gene Sequence: YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
• Gene ID - Mouse: ENSMUSG00000026668
• Gene ID - Rat: ENSRNOG00000017987
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.