Anti UCK1 pAb (ATL-HPA050969)

Atlas Antibodies

SKU: ATL-HPA050969-25

• 
• 
• 

Protein Description: uridine-cytidine kinase 1
Gene Name: UCK1
Alternative Gene Name: FLJ12255, URK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002550: 82%, ENSRNOG00000011467: 84%
Entrez Gene ID: 83549
Uniprot ID: Q9HA47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRP
• Gene Sequence: IQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRP
• Gene ID - Mouse: ENSMUSG00000002550
• Gene ID - Rat: ENSRNOG00000011467
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.