Protein Description: ubiquitin carboxyl-terminal hydrolase L5
Gene Name: UCHL5
Alternative Gene Name: CGI-70, INO80R, UCH37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018189: 95%, ENSRNOG00000003545: 96%
Entrez Gene ID: 51377
Uniprot ID: Q9Y5K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UCHL5
Alternative Gene Name: CGI-70, INO80R, UCH37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018189: 95%, ENSRNOG00000003545: 96%
Entrez Gene ID: 51377
Uniprot ID: Q9Y5K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT |
| Documents & Links for Anti UCHL5 pAb (ATL-HPA075383) | |
| Datasheet | Anti UCHL5 pAb (ATL-HPA075383) Datasheet (External Link) |
| Vendor Page | Anti UCHL5 pAb (ATL-HPA075383) at Atlas |
| Documents & Links for Anti UCHL5 pAb (ATL-HPA075383) | |
| Datasheet | Anti UCHL5 pAb (ATL-HPA075383) Datasheet (External Link) |
| Vendor Page | Anti UCHL5 pAb (ATL-HPA075383) |