Anti UBXN7 pAb (ATL-HPA048441 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048441-25

• 
• 

Protein Description: UBX domain protein 7
Gene Name: UBXN7
Alternative Gene Name: KIAA0794, UBXD7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053774: 93%, ENSRNOG00000046969: 94%
Entrez Gene ID: 26043
Uniprot ID: O94888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRR
• Gene Sequence: TATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRR
• Gene ID - Mouse: ENSMUSG00000053774
• Gene ID - Rat: ENSRNOG00000046969
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.