Anti UBXN2B pAb (ATL-HPA045278)
Atlas Antibodies
- SKU:
- ATL-HPA045278-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: UBXN2B
Alternative Gene Name: p37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028243: 69%, ENSRNOG00000009137: 75%
Entrez Gene ID: 137886
Uniprot ID: Q14CS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHEYSGLNIVRPS |
Gene Sequence | GEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHEYSGLNIVRPS |
Gene ID - Mouse | ENSMUSG00000028243 |
Gene ID - Rat | ENSRNOG00000009137 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UBXN2B pAb (ATL-HPA045278) | |
Datasheet | Anti UBXN2B pAb (ATL-HPA045278) Datasheet (External Link) |
Vendor Page | Anti UBXN2B pAb (ATL-HPA045278) at Atlas Antibodies |
Documents & Links for Anti UBXN2B pAb (ATL-HPA045278) | |
Datasheet | Anti UBXN2B pAb (ATL-HPA045278) Datasheet (External Link) |
Vendor Page | Anti UBXN2B pAb (ATL-HPA045278) |