![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101704/181858/atl-hpa076932_anti-ubxn1-pab-atl-hpa076932_63526__98288.1681138281.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: UBX domain protein 1
Gene Name: UBXN1
Alternative Gene Name: 2B28, LOC51035, SAKS1, UBXD10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071655: 91%, ENSRNOG00000019666: 87%
Entrez Gene ID: 51035
Uniprot ID: Q04323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBXN1
Alternative Gene Name: 2B28, LOC51035, SAKS1, UBXD10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071655: 91%, ENSRNOG00000019666: 87%
Entrez Gene ID: 51035
Uniprot ID: Q04323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG |
| Documents & Links for Anti UBXN1 pAb (ATL-HPA076932) | |
| Datasheet | Anti UBXN1 pAb (ATL-HPA076932) Datasheet (External Link) |
| Vendor Page | Anti UBXN1 pAb (ATL-HPA076932) at Atlas |
| Documents & Links for Anti UBXN1 pAb (ATL-HPA076932) | |
| Datasheet | Anti UBXN1 pAb (ATL-HPA076932) Datasheet (External Link) |
| Vendor Page | Anti UBXN1 pAb (ATL-HPA076932) |