Protein Description: ubinuclein 1
Gene Name: UBN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039473: 71%, ENSRNOG00000003019: 72%
Entrez Gene ID: 29855
Uniprot ID: Q9NPG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039473: 71%, ENSRNOG00000003019: 72%
Entrez Gene ID: 29855
Uniprot ID: Q9NPG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SGTVLLAGSSLMASPYKSSSPKLSGAMSSNSLGIITPVPIPVHVLSFSADSSAKAGVSKDAIVTGPAPGSFHH |
| Documents & Links for Anti UBN1 pAb (ATL-HPA069036) | |
| Datasheet | Anti UBN1 pAb (ATL-HPA069036) Datasheet (External Link) |
| Vendor Page | Anti UBN1 pAb (ATL-HPA069036) at Atlas |
| Documents & Links for Anti UBN1 pAb (ATL-HPA069036) | |
| Datasheet | Anti UBN1 pAb (ATL-HPA069036) Datasheet (External Link) |
| Vendor Page | Anti UBN1 pAb (ATL-HPA069036) |