Anti UBE2W pAb (ATL-HPA045161)

Atlas Antibodies

SKU: ATL-HPA045161-100

• 
• 

Protein Description: ubiquitin-conjugating enzyme E2W (putative)
Gene Name: UBE2W
Alternative Gene Name: FLJ11011
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025939: 99%, ENSRNOG00000050465: 100%
Entrez Gene ID: 55284
Uniprot ID: Q96B02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWY
• Gene Sequence: DPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWY
• Gene ID - Mouse: ENSMUSG00000025939
• Gene ID - Rat: ENSRNOG00000050465
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UBE2W pAb (ATL-HPA045161) – 1 Found

Liyasova, Mariya S; Ma, Ke; Voeller, Donna; Ryan, Philip E; Chen, Jinqiu; Klevit, Rachel E; Lipkowitz, Stanley. Cbl interacts with multiple E2s in vitro and in cells. Plos One. 14(5):e0216967.