Anti UBE2N pAb (ATL-HPA044976 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044976-25

• 
• 
• 

Protein Description: ubiquitin-conjugating enzyme E2N
Gene Name: UBE2N
Alternative Gene Name: MGC8489, UBC13, UbcH-ben
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074781: 100%, ENSRNOG00000058053: 100%
Entrez Gene ID: 7334
Uniprot ID: P61088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA
• Gene Sequence: IIKETQRLLAEPVPGIKAEPDESNARYFHVVIA
• Gene ID - Mouse: ENSMUSG00000074781
• Gene ID - Rat: ENSRNOG00000058053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.