Anti UBE2L3 pAb (ATL-HPA062415)

Atlas Antibodies

Catalog No.:
ATL-HPA062415-25
Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts and Leydig cells.
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ubiquitin conjugating enzyme E2 L3
Gene Name: UBE2L3
Alternative Gene Name: UBCH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038965: 100%, ENSRNOG00000030467: 51%
Entrez Gene ID: 7332
Uniprot ID: P68036
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Gene Sequence CLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Gene ID - Mouse ENSMUSG00000038965
Gene ID - Rat ENSRNOG00000030467
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UBE2L3 pAb (ATL-HPA062415)
Datasheet Anti UBE2L3 pAb (ATL-HPA062415) Datasheet (External Link)
Vendor Page Anti UBE2L3 pAb (ATL-HPA062415) at Atlas Antibodies

Documents & Links for Anti UBE2L3 pAb (ATL-HPA062415)
Datasheet Anti UBE2L3 pAb (ATL-HPA062415) Datasheet (External Link)
Vendor Page Anti UBE2L3 pAb (ATL-HPA062415)



!