Anti UBE2G1 pAb (ATL-HPA050551)

Atlas Antibodies

SKU: ATL-HPA050551-100

• 
• 
• 

Protein Description: ubiquitin-conjugating enzyme E2G 1
Gene Name: UBE2G1
Alternative Gene Name: UBC7, UBE2G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020794: 100%, ENSRNOG00000010041: 100%
Entrez Gene ID: 7326
Uniprot ID: P62253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVA
• Gene Sequence: RWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVA
• Gene ID - Mouse: ENSMUSG00000020794
• Gene ID - Rat: ENSRNOG00000010041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.