Anti UBB pAb (ATL-HPA049132)

Atlas Antibodies

SKU:
ATL-HPA049132-25
  • Immunohistochemical staining of human urinary bladder shows nuclear and cytoplasmic positivity in urothelial cells.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ubiquitin B
Gene Name: UBB
Alternative Gene Name: FLJ25987, MGC8385
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019505: 100%, ENSRNOG00000057823: 100%
Entrez Gene ID: 7314
Uniprot ID: P0CG47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
Gene Sequence GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
Gene ID - Mouse ENSMUSG00000019505
Gene ID - Rat ENSRNOG00000057823
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UBB pAb (ATL-HPA049132)
Datasheet Anti UBB pAb (ATL-HPA049132) Datasheet (External Link)
Vendor Page Anti UBB pAb (ATL-HPA049132) at Atlas Antibodies

Documents & Links for Anti UBB pAb (ATL-HPA049132)
Datasheet Anti UBB pAb (ATL-HPA049132) Datasheet (External Link)
Vendor Page Anti UBB pAb (ATL-HPA049132)



Citations for Anti UBB pAb (ATL-HPA049132) – 1 Found
Guo, Yi-Nan; Dong, Hao; Ma, Fu-Chao; Huang, Jing-Jv; Liang, Kai-Zhi; Peng, Jia-Li; Chen, Gang; Wei, Kang-Lai. The clinicopathological significance of decreased miR-125b-5p in hepatocellular carcinoma: evidence based on RT-qPCR, microRNA-microarray, and microRNA-sequencing. International Journal Of Clinical And Experimental Pathology. 12(1):21-39.  PubMed
!