Protein Description: UBA-like domain containing 1
Gene Name: UBALD1
Alternative Gene Name: FAM100A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039568: 87%, ENSRNOG00000046295: 89%
Entrez Gene ID: 124402
Uniprot ID: Q8TB05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBALD1
Alternative Gene Name: FAM100A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039568: 87%, ENSRNOG00000046295: 89%
Entrez Gene ID: 124402
Uniprot ID: Q8TB05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER |
Documents & Links for Anti UBALD1 pAb (ATL-HPA066771) | |
Datasheet | Anti UBALD1 pAb (ATL-HPA066771) Datasheet (External Link) |
Vendor Page | Anti UBALD1 pAb (ATL-HPA066771) at Atlas |
Documents & Links for Anti UBALD1 pAb (ATL-HPA066771) | |
Datasheet | Anti UBALD1 pAb (ATL-HPA066771) Datasheet (External Link) |
Vendor Page | Anti UBALD1 pAb (ATL-HPA066771) |