Anti UBALD1 pAb (ATL-HPA066771)

Atlas Antibodies

SKU: ATL-HPA066771-25

• 
• 
• 

Product Description

Protein Description: UBA-like domain containing 1
Gene Name: UBALD1
Alternative Gene Name: FAM100A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039568: 87%, ENSRNOG00000046295: 89%
Entrez Gene ID: 124402
Uniprot ID: Q8TB05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
• Gene Sequence: MFSRLKASESFHSGGSGSPMAATATSPPPHFPHAATSSSAASSWPTAASPPGGPQHHQPQPPLWTPTPPSPASDWPPLAPQQATSEPRAHPAMEAER
• Gene ID - Mouse: ENSMUSG00000039568
• Gene ID - Rat: ENSRNOG00000046295
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links