Protein Description: ubiquitin-like modifier activating enzyme 3
Gene Name: UBA3
Alternative Gene Name: hUba3, NAE2, UBE1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030061: 100%, ENSRNOG00000006221: 100%
Entrez Gene ID: 9039
Uniprot ID: Q8TBC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: UBA3
Alternative Gene Name: hUba3, NAE2, UBE1C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030061: 100%, ENSRNOG00000006221: 100%
Entrez Gene ID: 9039
Uniprot ID: Q8TBC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE |
Documents & Links for Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation) | |
Datasheet | Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation) at Atlas |
Documents & Links for Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation) | |
Datasheet | Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti UBA3 pAb (ATL-HPA065335 w/enhanced validation) |