Anti TYW5 pAb (ATL-HPA045803)

Atlas Antibodies

SKU:
ATL-HPA045803-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tRNA-yW synthesizing protein 5
Gene Name: TYW5
Alternative Gene Name: C2orf60, FLJ37953
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048495: 90%, ENSRNOG00000010100: 89%
Entrez Gene ID: 129450
Uniprot ID: A2RUC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMV
Gene Sequence KRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMV
Gene ID - Mouse ENSMUSG00000048495
Gene ID - Rat ENSRNOG00000010100
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TYW5 pAb (ATL-HPA045803)
Datasheet Anti TYW5 pAb (ATL-HPA045803) Datasheet (External Link)
Vendor Page Anti TYW5 pAb (ATL-HPA045803) at Atlas Antibodies

Documents & Links for Anti TYW5 pAb (ATL-HPA045803)
Datasheet Anti TYW5 pAb (ATL-HPA045803) Datasheet (External Link)
Vendor Page Anti TYW5 pAb (ATL-HPA045803)