Anti TXN pAb (ATL-HPA047478 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047478-25
  • Immunohistochemistry analysis in human colon and skeletal muscle tissues using HPA047478 antibody. Corresponding TXN RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: thioredoxin
Gene Name: TXN
Alternative Gene Name: TRX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028367: 88%, ENSRNOG00000012081: 88%
Entrez Gene ID: 7295
Uniprot ID: P10599
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA
Gene Sequence SLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGA
Gene ID - Mouse ENSMUSG00000028367
Gene ID - Rat ENSRNOG00000012081
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TXN pAb (ATL-HPA047478 w/enhanced validation)
Datasheet Anti TXN pAb (ATL-HPA047478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TXN pAb (ATL-HPA047478 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TXN pAb (ATL-HPA047478 w/enhanced validation)
Datasheet Anti TXN pAb (ATL-HPA047478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TXN pAb (ATL-HPA047478 w/enhanced validation)



Citations for Anti TXN pAb (ATL-HPA047478 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed