Anti TXLNG pAb (ATL-HPA000297 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA000297-25
  • Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-TXLNG antibody. Corresponding TXLNG RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell lines HEK293 and MCF-7 using Anti-TXLNG antibody. Corresponding TXLNG RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: taxilin gamma
Gene Name: TXLNG
Alternative Gene Name: CXorf15, FIAT, FLJ11209, LSR5, MGC126621, MGC126625, TXLNGX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038344: 73%, ENSRNOG00000004971: 75%
Entrez Gene ID: 55787
Uniprot ID: Q9NUQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KALLQMAEEKTVRDKEYKALQIKLERLEKLCRALQTERNELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAP
Gene Sequence KALLQMAEEKTVRDKEYKALQIKLERLEKLCRALQTERNELNEKVEVLKEQVSIKAAIKAANRDLATPVMQPCTALDSHKELNTSSKRALGAHLEAEPKSQRSAVQKPPSTGSAP
Gene ID - Mouse ENSMUSG00000038344
Gene ID - Rat ENSRNOG00000004971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TXLNG pAb (ATL-HPA000297 w/enhanced validation)
Datasheet Anti TXLNG pAb (ATL-HPA000297 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TXLNG pAb (ATL-HPA000297 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TXLNG pAb (ATL-HPA000297 w/enhanced validation)
Datasheet Anti TXLNG pAb (ATL-HPA000297 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TXLNG pAb (ATL-HPA000297 w/enhanced validation)