Anti TWF2 pAb (ATL-HPA053874)

Atlas Antibodies

SKU: ATL-HPA053874-100

• 
• 

Protein Description: twinfilin actin-binding protein 2
Gene Name: TWF2
Alternative Gene Name: A6r, A6RP, PTK9L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023277: 94%, ENSRNOG00000048915: 94%
Entrez Gene ID: 11344
Uniprot ID: Q6IBS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYR
• Gene Sequence: HQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYR
• Gene ID - Mouse: ENSMUSG00000023277
• Gene ID - Rat: ENSRNOG00000048915
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.