Protein Description: trans-golgi network vesicle protein 23 homolog C (S. cerevisiae)
Gene Name: TVP23C
Alternative Gene Name: FAM18B2, MGC8763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014177: 93%, ENSRNOG00000050649: 87%
Entrez Gene ID: 201158
Uniprot ID: Q96ET8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TVP23C
Alternative Gene Name: FAM18B2, MGC8763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014177: 93%, ENSRNOG00000050649: 87%
Entrez Gene ID: 201158
Uniprot ID: Q96ET8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MLQQDSNDDTEDVSLFDAEEETTNRPRKAK |
| Documents & Links for Anti TVP23C pAb (ATL-HPA065603) | |
| Datasheet | Anti TVP23C pAb (ATL-HPA065603) Datasheet (External Link) |
| Vendor Page | Anti TVP23C pAb (ATL-HPA065603) at Atlas |
| Documents & Links for Anti TVP23C pAb (ATL-HPA065603) | |
| Datasheet | Anti TVP23C pAb (ATL-HPA065603) Datasheet (External Link) |
| Vendor Page | Anti TVP23C pAb (ATL-HPA065603) |