Anti TVP23A pAb (ATL-HPA060582)

Atlas Antibodies

SKU: ATL-HPA060582-25

• 
• 

Protein Description: trans-golgi network vesicle protein 23 homolog A (S. cerevisiae)
Gene Name: TVP23A
Alternative Gene Name: FAM18A, YDR084C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050908: 73%, ENSRNOG00000025545: 71%
Entrez Gene ID: 780776
Uniprot ID: A6NH52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILCKMGGNSDIGKVTASFLSQTVFQTACPGDFQKPGLEGLEIHQH
• Gene Sequence: ILCKMGGNSDIGKVTASFLSQTVFQTACPGDFQKPGLEGLEIHQH
• Gene ID - Mouse: ENSMUSG00000050908
• Gene ID - Rat: ENSRNOG00000025545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.