Protein Description: terminal uridylyl transferase 1, U6 snRNA-specific
Gene Name: TUT1
Alternative Gene Name: FLJ21850, FLJ22267, FLJ22347, PAPD2, RBM21, TUTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071645: 69%, ENSRNOG00000020047: 67%
Entrez Gene ID: 64852
Uniprot ID: Q9H6E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TUT1
Alternative Gene Name: FLJ21850, FLJ22267, FLJ22347, PAPD2, RBM21, TUTase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071645: 69%, ENSRNOG00000020047: 67%
Entrez Gene ID: 64852
Uniprot ID: Q9H6E5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPADRMLTVTPLQDPQGLFPDLHHFLQVFLPQAIR |
| Documents & Links for Anti TUT1 pAb (ATL-HPA069055) | |
| Datasheet | Anti TUT1 pAb (ATL-HPA069055) Datasheet (External Link) |
| Vendor Page | Anti TUT1 pAb (ATL-HPA069055) at Atlas |
| Documents & Links for Anti TUT1 pAb (ATL-HPA069055) | |
| Datasheet | Anti TUT1 pAb (ATL-HPA069055) Datasheet (External Link) |
| Vendor Page | Anti TUT1 pAb (ATL-HPA069055) |