Protein Description: tubby like protein 2
Gene Name: TULP2
Alternative Gene Name: CT65, TUBL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039239: 30%, ENSRNOG00000020927: 32%
Entrez Gene ID: 7288
Uniprot ID: O00295
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TULP2
Alternative Gene Name: CT65, TUBL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039239: 30%, ENSRNOG00000020927: 32%
Entrez Gene ID: 7288
Uniprot ID: O00295
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAH |
| Documents & Links for Anti TULP2 pAb (ATL-HPA075828) | |
| Datasheet | Anti TULP2 pAb (ATL-HPA075828) Datasheet (External Link) |
| Vendor Page | Anti TULP2 pAb (ATL-HPA075828) at Atlas |
| Documents & Links for Anti TULP2 pAb (ATL-HPA075828) | |
| Datasheet | Anti TULP2 pAb (ATL-HPA075828) Datasheet (External Link) |
| Vendor Page | Anti TULP2 pAb (ATL-HPA075828) |