Anti TUFT1 pAb (ATL-HPA054301)

Atlas Antibodies

SKU:
ATL-HPA054301-25
  • Immunohistochemical staining of human Skin shows moderate cytoplasmic positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tuftelin 1
Gene Name: TUFT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005968: 84%, ENSRNOG00000020923: 84%
Entrez Gene ID: 7286
Uniprot ID: Q9NNX1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSEVQYIQEARNCLQKLREDISSKLDRNLGDSLHRQEIQVVLEKPNGFSQSPTALYSSPPEVDTCINEDVESLRKTVQDL
Gene Sequence KSEVQYIQEARNCLQKLREDISSKLDRNLGDSLHRQEIQVVLEKPNGFSQSPTALYSSPPEVDTCINEDVESLRKTVQDL
Gene ID - Mouse ENSMUSG00000005968
Gene ID - Rat ENSRNOG00000020923
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TUFT1 pAb (ATL-HPA054301)
Datasheet Anti TUFT1 pAb (ATL-HPA054301) Datasheet (External Link)
Vendor Page Anti TUFT1 pAb (ATL-HPA054301) at Atlas Antibodies

Documents & Links for Anti TUFT1 pAb (ATL-HPA054301)
Datasheet Anti TUFT1 pAb (ATL-HPA054301) Datasheet (External Link)
Vendor Page Anti TUFT1 pAb (ATL-HPA054301)