Anti TUBAL3 pAb (ATL-HPA045900)

Atlas Antibodies

Catalog No.:
ATL-HPA045900-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tubulin, alpha-like 3
Gene Name: TUBAL3
Alternative Gene Name: FLJ21665
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021216: 68%, ENSRNOG00000020915: 32%
Entrez Gene ID: 79861
Uniprot ID: A6NHL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQPNGVVLDTQQDQLENAKMEHTNASFDTFF
Gene Sequence IQPNGVVLDTQQDQLENAKMEHTNASFDTFF
Gene ID - Mouse ENSMUSG00000021216
Gene ID - Rat ENSRNOG00000020915
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TUBAL3 pAb (ATL-HPA045900)
Datasheet Anti TUBAL3 pAb (ATL-HPA045900) Datasheet (External Link)
Vendor Page Anti TUBAL3 pAb (ATL-HPA045900) at Atlas Antibodies

Documents & Links for Anti TUBAL3 pAb (ATL-HPA045900)
Datasheet Anti TUBAL3 pAb (ATL-HPA045900) Datasheet (External Link)
Vendor Page Anti TUBAL3 pAb (ATL-HPA045900)