Anti TTLL9 pAb (ATL-HPA055676)

Atlas Antibodies

SKU: ATL-HPA055676-25

• 

Protein Description: tubulin tyrosine ligase-like family, member 9
Gene Name: TTLL9
Alternative Gene Name: C20orf125, dJ310O13.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074673: 92%, ENSRNOG00000008596: 94%
Entrez Gene ID: 164395
Uniprot ID: Q3SXZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTNVAVQKTSPDYHPKKGCKWTLQRFRQYLASKHGPEAVETLFRDIDNIFVKSLQSVQKVIISDKHCFELY
• Gene Sequence: LTNVAVQKTSPDYHPKKGCKWTLQRFRQYLASKHGPEAVETLFRDIDNIFVKSLQSVQKVIISDKHCFELY
• Gene ID - Mouse: ENSMUSG00000074673
• Gene ID - Rat: ENSRNOG00000008596
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.