Anti TTLL7 pAb (ATL-HPA052249)

Atlas Antibodies

SKU: ATL-HPA052249-25

• 

Protein Description: tubulin tyrosine ligase-like family, member 7
Gene Name: TTLL7
Alternative Gene Name: FLJ23033
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036745: 62%, ENSRNOG00000031997: 61%
Entrez Gene ID: 79739
Uniprot ID: Q6ZT98
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEYQNKKREKQVTYNLKPSNHYKLIQQPSSIRRSVSCPRSISAQSPSSGDTRPFSAQQMISVSRPTSASRS
• Gene Sequence: EEYQNKKREKQVTYNLKPSNHYKLIQQPSSIRRSVSCPRSISAQSPSSGDTRPFSAQQMISVSRPTSASRS
• Gene ID - Mouse: ENSMUSG00000036745
• Gene ID - Rat: ENSRNOG00000031997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.