Anti TTLL1 pAb (ATL-HPA048392)

Atlas Antibodies

SKU: ATL-HPA048392-25

• 
• 

Protein Description: tubulin tyrosine ligase-like family, member 1
Gene Name: TTLL1
Alternative Gene Name: C22orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022442: 93%, ENSRNOG00000010141: 93%
Entrez Gene ID: 25809
Uniprot ID: O95922
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLTTWK
• Gene Sequence: SLTSSTANDRILKYNLINDTLNIAVPNGEIPDCKWNKSPPKEVLGNYEILYDEELAQGDGADRELRSRQGQSLGPRAGRSRDSGRAVLTTWK
• Gene ID - Mouse: ENSMUSG00000022442
• Gene ID - Rat: ENSRNOG00000010141
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.