Anti TTF2 pAb (ATL-HPA070762)

Atlas Antibodies

SKU: ATL-HPA070762-25

• 

Protein Description: transcription termination factor, RNA polymerase II
Gene Name: TTF2
Alternative Gene Name: HuF2, ZGRF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033222: 61%, ENSRNOG00000057761: 24%
Entrez Gene ID: 8458
Uniprot ID: Q9UNY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQLIKGE
• Gene Sequence: VELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSKEHSVSNKSQHASETFHHSSNWLRNPFKVLDKNQEPALWKQLIKGE
• Gene ID - Mouse: ENSMUSG00000033222
• Gene ID - Rat: ENSRNOG00000057761
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.