Anti TTC9C pAb (ATL-HPA055169)

Atlas Antibodies

SKU:
ATL-HPA055169-25
  • Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 9C
Gene Name: TTC9C
Alternative Gene Name: MGC29649
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071660: 93%, ENSRNOG00000019464: 97%
Entrez Gene ID: 283237
Uniprot ID: Q8N5M4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCY
Gene Sequence MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCY
Gene ID - Mouse ENSMUSG00000071660
Gene ID - Rat ENSRNOG00000019464
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TTC9C pAb (ATL-HPA055169)
Datasheet Anti TTC9C pAb (ATL-HPA055169) Datasheet (External Link)
Vendor Page Anti TTC9C pAb (ATL-HPA055169) at Atlas Antibodies

Documents & Links for Anti TTC9C pAb (ATL-HPA055169)
Datasheet Anti TTC9C pAb (ATL-HPA055169) Datasheet (External Link)
Vendor Page Anti TTC9C pAb (ATL-HPA055169)