Anti TTC30A pAb (ATL-HPA052487)

Atlas Antibodies

SKU: ATL-HPA052487-25

• 
• 

Protein Description: tetratricopeptide repeat domain 30A
Gene Name: TTC30A
Alternative Gene Name: FLJ13946, IFT70A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075273: 94%, ENSRNOG00000059460: 92%
Entrez Gene ID: 92104
Uniprot ID: Q86WT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEA
• Gene Sequence: LSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEA
• Gene ID - Mouse: ENSMUSG00000075273
• Gene ID - Rat: ENSRNOG00000059460
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.