Anti TTC30A pAb (ATL-HPA052100)

Atlas Antibodies

SKU:
ATL-HPA052100-25
  • Immunohistochemical staining of human fallopian tube shows strong positivity in ciliated cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 30A
Gene Name: TTC30A
Alternative Gene Name: FLJ13946, IFT70A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075271: 99%, ENSRNOG00000059460: 98%
Entrez Gene ID: 92104
Uniprot ID: Q86WT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFL
Gene Sequence ETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFL
Gene ID - Mouse ENSMUSG00000075271
Gene ID - Rat ENSRNOG00000059460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TTC30A pAb (ATL-HPA052100)
Datasheet Anti TTC30A pAb (ATL-HPA052100) Datasheet (External Link)
Vendor Page Anti TTC30A pAb (ATL-HPA052100) at Atlas Antibodies

Documents & Links for Anti TTC30A pAb (ATL-HPA052100)
Datasheet Anti TTC30A pAb (ATL-HPA052100) Datasheet (External Link)
Vendor Page Anti TTC30A pAb (ATL-HPA052100)