Anti TTC19 pAb (ATL-HPA052380 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052380-25

• 
• 
• 

Protein Description: tetratricopeptide repeat domain 19
Gene Name: TTC19
Alternative Gene Name: FLJ20343, MGC19520
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042298: 89%, ENSRNOG00000002977: 89%
Entrez Gene ID: 54902
Uniprot ID: Q6DKK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TIVLMSDLATTLDAQGRFDEAYIYMQRASDLARQINHPELHMVLSNLAAVLMHRERYTQAKEIYQEALKQAKLKKDEISVQHIREELAELSKKS
• Gene Sequence: TIVLMSDLATTLDAQGRFDEAYIYMQRASDLARQINHPELHMVLSNLAAVLMHRERYTQAKEIYQEALKQAKLKKDEISVQHIREELAELSKKS
• Gene ID - Mouse: ENSMUSG00000042298
• Gene ID - Rat: ENSRNOG00000002977
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.