Anti TTC12 pAb (ATL-HPA061364)

Atlas Antibodies

SKU:
ATL-HPA061364-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in  cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tetratricopeptide repeat domain 12
Gene Name: TTC12
Alternative Gene Name: FLJ13859, FLJ20535, TPARM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040219: 77%, ENSRNOG00000008595: 79%
Entrez Gene ID: 54970
Uniprot ID: Q9H892
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSDDPVVQQKAVLETEKRLLLMEEDQEEDECRTTLNKTMISPPQTAMKSAEEINSEAFLASVEKDAKERAKRRRENKV
Gene Sequence NSDDPVVQQKAVLETEKRLLLMEEDQEEDECRTTLNKTMISPPQTAMKSAEEINSEAFLASVEKDAKERAKRRRENKV
Gene ID - Mouse ENSMUSG00000040219
Gene ID - Rat ENSRNOG00000008595
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TTC12 pAb (ATL-HPA061364)
Datasheet Anti TTC12 pAb (ATL-HPA061364) Datasheet (External Link)
Vendor Page Anti TTC12 pAb (ATL-HPA061364) at Atlas Antibodies

Documents & Links for Anti TTC12 pAb (ATL-HPA061364)
Datasheet Anti TTC12 pAb (ATL-HPA061364) Datasheet (External Link)
Vendor Page Anti TTC12 pAb (ATL-HPA061364)