Anti TSR3 pAb (ATL-HPA046265)

Atlas Antibodies

SKU: ATL-HPA046265-25

• 

Protein Description: TSR3, 20S rRNA accumulation, homolog (S. cerevisiae)
Gene Name: TSR3
Alternative Gene Name: C16orf42, MGC24381
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015126: 68%, ENSRNOG00000017858: 74%
Entrez Gene ID: 115939
Uniprot ID: Q9UJK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLANAKESPQEEEIDPFDVDSGREFGNPNRPVASTRLPSDTDDSDASEDP
• Gene Sequence: FLANAKESPQEEEIDPFDVDSGREFGNPNRPVASTRLPSDTDDSDASEDP
• Gene ID - Mouse: ENSMUSG00000015126
• Gene ID - Rat: ENSRNOG00000017858
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.