Anti TSR3 pAb (ATL-HPA046265)

Atlas Antibodies

SKU:
ATL-HPA046265-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TSR3, 20S rRNA accumulation, homolog (S. cerevisiae)
Gene Name: TSR3
Alternative Gene Name: C16orf42, MGC24381
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015126: 68%, ENSRNOG00000017858: 74%
Entrez Gene ID: 115939
Uniprot ID: Q9UJK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLANAKESPQEEEIDPFDVDSGREFGNPNRPVASTRLPSDTDDSDASEDP
Gene Sequence FLANAKESPQEEEIDPFDVDSGREFGNPNRPVASTRLPSDTDDSDASEDP
Gene ID - Mouse ENSMUSG00000015126
Gene ID - Rat ENSRNOG00000017858
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TSR3 pAb (ATL-HPA046265)
Datasheet Anti TSR3 pAb (ATL-HPA046265) Datasheet (External Link)
Vendor Page Anti TSR3 pAb (ATL-HPA046265) at Atlas Antibodies

Documents & Links for Anti TSR3 pAb (ATL-HPA046265)
Datasheet Anti TSR3 pAb (ATL-HPA046265) Datasheet (External Link)
Vendor Page Anti TSR3 pAb (ATL-HPA046265)