Anti TSPEAR pAb (ATL-HPA052995)

Atlas Antibodies

SKU:
ATL-HPA052995-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: thrombospondin-type laminin G domain and EAR repeats
Gene Name: TSPEAR
Alternative Gene Name: C21orf29, DFNB98, MGC11251, TSP-EAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069581: 88%, ENSRNOG00000001219: 89%
Entrez Gene ID: 54084
Uniprot ID: Q8WU66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST
Gene Sequence KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST
Gene ID - Mouse ENSMUSG00000069581
Gene ID - Rat ENSRNOG00000001219
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TSPEAR pAb (ATL-HPA052995)
Datasheet Anti TSPEAR pAb (ATL-HPA052995) Datasheet (External Link)
Vendor Page Anti TSPEAR pAb (ATL-HPA052995) at Atlas Antibodies

Documents & Links for Anti TSPEAR pAb (ATL-HPA052995)
Datasheet Anti TSPEAR pAb (ATL-HPA052995) Datasheet (External Link)
Vendor Page Anti TSPEAR pAb (ATL-HPA052995)