Anti TSC2 pAb (ATL-HPA049679)

Atlas Antibodies

SKU:
ATL-HPA049679-25
  • Immunofluorescent staining of human cell line HeLa shows localization to cytosol.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: tuberous sclerosis 2
Gene Name: TSC2
Alternative Gene Name: LAM, PPP1R160, TSC4, tuberin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002496: 86%, ENSRNOG00000011375: 85%
Entrez Gene ID: 7249
Uniprot ID: P49815
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV
Gene Sequence SQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV
Gene ID - Mouse ENSMUSG00000002496
Gene ID - Rat ENSRNOG00000011375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TSC2 pAb (ATL-HPA049679)
Datasheet Anti TSC2 pAb (ATL-HPA049679) Datasheet (External Link)
Vendor Page Anti TSC2 pAb (ATL-HPA049679) at Atlas Antibodies

Documents & Links for Anti TSC2 pAb (ATL-HPA049679)
Datasheet Anti TSC2 pAb (ATL-HPA049679) Datasheet (External Link)
Vendor Page Anti TSC2 pAb (ATL-HPA049679)