Anti TRUB2 pAb (ATL-HPA052190)

Atlas Antibodies

SKU:
ATL-HPA052190-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TruB pseudouridine (psi) synthase family member 2
Gene Name: TRUB2
Alternative Gene Name: CLONE24922
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039826: 89%, ENSRNOG00000043189: 88%
Entrez Gene ID: 26995
Uniprot ID: O95900
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA
Gene Sequence ALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA
Gene ID - Mouse ENSMUSG00000039826
Gene ID - Rat ENSRNOG00000043189
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRUB2 pAb (ATL-HPA052190)
Datasheet Anti TRUB2 pAb (ATL-HPA052190) Datasheet (External Link)
Vendor Page Anti TRUB2 pAb (ATL-HPA052190) at Atlas Antibodies

Documents & Links for Anti TRUB2 pAb (ATL-HPA052190)
Datasheet Anti TRUB2 pAb (ATL-HPA052190) Datasheet (External Link)
Vendor Page Anti TRUB2 pAb (ATL-HPA052190)