Anti TRUB1 pAb (ATL-HPA057552)

Atlas Antibodies

SKU: ATL-HPA057552-25

• 

Protein Description: TruB pseudouridine (psi) synthase family member 1
Gene Name: TRUB1
Alternative Gene Name: PUS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025086: 91%, ENSRNOG00000017321: 90%
Entrez Gene ID: 142940
Uniprot ID: Q8WWH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLLSLSGVFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLTSMLSGSKRYTAIGELGK
• Gene Sequence: KLLSLSGVFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLTSMLSGSKRYTAIGELGK
• Gene ID - Mouse: ENSMUSG00000025086
• Gene ID - Rat: ENSRNOG00000017321
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.