Anti TRRAP pAb (ATL-HPA054376)

Atlas Antibodies

SKU:
ATL-HPA054376-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transformation/transcription domain-associated protein
Gene Name: TRRAP
Alternative Gene Name: PAF400, TR-AP, Tra1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045482: 99%, ENSRNOG00000019497: 21%
Entrez Gene ID: 8295
Uniprot ID: Q9Y4A5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ
Gene Sequence TWVQLFPRLWKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTHNLWFRSTLMLEHQ
Gene ID - Mouse ENSMUSG00000045482
Gene ID - Rat ENSRNOG00000019497
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRRAP pAb (ATL-HPA054376)
Datasheet Anti TRRAP pAb (ATL-HPA054376) Datasheet (External Link)
Vendor Page Anti TRRAP pAb (ATL-HPA054376) at Atlas Antibodies

Documents & Links for Anti TRRAP pAb (ATL-HPA054376)
Datasheet Anti TRRAP pAb (ATL-HPA054376) Datasheet (External Link)
Vendor Page Anti TRRAP pAb (ATL-HPA054376)