Protein Description: transient receptor potential cation channel, subfamily V, member 3
Gene Name: TRPV3
Alternative Gene Name: VRL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043029: 89%, ENSRNOG00000019606: 89%
Entrez Gene ID: 162514
Uniprot ID: Q8NET8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRPV3
Alternative Gene Name: VRL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043029: 89%, ENSRNOG00000019606: 89%
Entrez Gene ID: 162514
Uniprot ID: Q8NET8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETS |
Documents & Links for Anti TRPV3 pAb (ATL-HPA069550) | |
Datasheet | Anti TRPV3 pAb (ATL-HPA069550) Datasheet (External Link) |
Vendor Page | Anti TRPV3 pAb (ATL-HPA069550) at Atlas |
Documents & Links for Anti TRPV3 pAb (ATL-HPA069550) | |
Datasheet | Anti TRPV3 pAb (ATL-HPA069550) Datasheet (External Link) |
Vendor Page | Anti TRPV3 pAb (ATL-HPA069550) |