Anti TRPV2 pAb (ATL-HPA044993)

Atlas Antibodies

SKU: ATL-HPA044993-25

• 
• 

Protein Description: transient receptor potential cation channel, subfamily V, member 2
Gene Name: TRPV2
Alternative Gene Name: VRL, VRL-1, VRL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018507: 71%, ENSRNOG00000003104: 59%
Entrez Gene ID: 51393
Uniprot ID: Q9Y5S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS
• Gene Sequence: RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS
• Gene ID - Mouse: ENSMUSG00000018507
• Gene ID - Rat: ENSRNOG00000003104
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRPV2 pAb (ATL-HPA044993) – 3 Found

Elbaz, Mohamad; Ahirwar, Dinesh; Xiaoli, Zhang; Zhou, Xinyu; Lustberg, Maryam; Nasser, Mohd W; Shilo, Konstantin; Ganju, Ramesh K. TRPV2 is a novel biomarker and therapeutic target in triple negative breast cancer. Oncotarget. 2018;9(71):33459-33470. 

Eubler, Katja; Herrmann, Carola; Tiefenbacher, Astrid; Köhn, Frank-Michael; Schwarzer, J Ullrich; Kunz, Lars; Mayerhofer, Artur. Ca(2+) Signaling and IL-8 Secretion in Human Testicular Peritubular Cells Involve the Cation Channel TRPV2. International Journal Of Molecular Sciences. 2018;19(9) 

Eubler, Katja; Rantakari, Pia; Gerke, Heidi; Herrmann, Carola; Missel, Annika; Schmid, Nina; Walenta, Lena; Lahiri, Shibojyoti; Imhof, Axel; Strauss, Leena; Poutanen, Matti; Mayerhofer, Artur. Exploring the Ion Channel TRPV2 and Testicular Macrophages in Mouse Testis. International Journal Of Molecular Sciences. 2021;22(9)