Anti TRPM3 pAb (ATL-HPA074393 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA074393-25

• 

Protein Description: transient receptor potential cation channel subfamily M member 3
Gene Name: TRPM3
Alternative Gene Name: GON-2, KIAA1616, LTRPC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052387: 100%, ENSRNOG00000027770: 100%
Entrez Gene ID: 80036
Uniprot ID: Q9HCF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQ
• Gene Sequence: VDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQ
• Gene ID - Mouse: ENSMUSG00000052387
• Gene ID - Rat: ENSRNOG00000027770
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.