Protein Description: transient receptor potential cation channel subfamily M member 3
Gene Name: TRPM3
Alternative Gene Name: GON-2, KIAA1616, LTRPC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052387: 100%, ENSRNOG00000027770: 100%
Entrez Gene ID: 80036
Uniprot ID: Q9HCF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRPM3
Alternative Gene Name: GON-2, KIAA1616, LTRPC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052387: 100%, ENSRNOG00000027770: 100%
Entrez Gene ID: 80036
Uniprot ID: Q9HCF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQ |
| Documents & Links for Anti TRPM3 pAb (ATL-HPA074393 w/enhanced validation) | |
| Datasheet | Anti TRPM3 pAb (ATL-HPA074393 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TRPM3 pAb (ATL-HPA074393 w/enhanced validation) at Atlas |
| Documents & Links for Anti TRPM3 pAb (ATL-HPA074393 w/enhanced validation) | |
| Datasheet | Anti TRPM3 pAb (ATL-HPA074393 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TRPM3 pAb (ATL-HPA074393 w/enhanced validation) |