Anti TRMT6 pAb (ATL-HPA050408)

Atlas Antibodies

SKU:
ATL-HPA050408-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: tRNA methyltransferase 6
Gene Name: TRMT6
Alternative Gene Name: CGI-09, GCD10, Gcd10p, MGC5029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037376: 97%, ENSRNOG00000021270: 98%
Entrez Gene ID: 51605
Uniprot ID: Q9UJA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKDKGIKGEEIVQQLIENSTTFRDKTEFAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGN
Gene Sequence LKDKGIKGEEIVQQLIENSTTFRDKTEFAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAREPGKINHMRYDTLAQMLTLGNIRAGN
Gene ID - Mouse ENSMUSG00000037376
Gene ID - Rat ENSRNOG00000021270
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRMT6 pAb (ATL-HPA050408)
Datasheet Anti TRMT6 pAb (ATL-HPA050408) Datasheet (External Link)
Vendor Page Anti TRMT6 pAb (ATL-HPA050408) at Atlas Antibodies

Documents & Links for Anti TRMT6 pAb (ATL-HPA050408)
Datasheet Anti TRMT6 pAb (ATL-HPA050408) Datasheet (External Link)
Vendor Page Anti TRMT6 pAb (ATL-HPA050408)