Anti TRMT6 pAb (ATL-HPA047032)
Atlas Antibodies
- SKU:
- ATL-HPA047032-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TRMT6
Alternative Gene Name: CGI-09, GCD10, Gcd10p, MGC5029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037376: 91%, ENSRNOG00000021270: 89%
Entrez Gene ID: 51605
Uniprot ID: Q9UJA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE |
Gene Sequence | KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE |
Gene ID - Mouse | ENSMUSG00000037376 |
Gene ID - Rat | ENSRNOG00000021270 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TRMT6 pAb (ATL-HPA047032) | |
Datasheet | Anti TRMT6 pAb (ATL-HPA047032) Datasheet (External Link) |
Vendor Page | Anti TRMT6 pAb (ATL-HPA047032) at Atlas Antibodies |
Documents & Links for Anti TRMT6 pAb (ATL-HPA047032) | |
Datasheet | Anti TRMT6 pAb (ATL-HPA047032) Datasheet (External Link) |
Vendor Page | Anti TRMT6 pAb (ATL-HPA047032) |