Anti TRMT6 pAb (ATL-HPA047032)

Atlas Antibodies

SKU:
ATL-HPA047032-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tRNA methyltransferase 6 homolog (S. cerevisiae)
Gene Name: TRMT6
Alternative Gene Name: CGI-09, GCD10, Gcd10p, MGC5029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037376: 91%, ENSRNOG00000021270: 89%
Entrez Gene ID: 51605
Uniprot ID: Q9UJA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE
Gene Sequence KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPKDSALVEESNGTLE
Gene ID - Mouse ENSMUSG00000037376
Gene ID - Rat ENSRNOG00000021270
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRMT6 pAb (ATL-HPA047032)
Datasheet Anti TRMT6 pAb (ATL-HPA047032) Datasheet (External Link)
Vendor Page Anti TRMT6 pAb (ATL-HPA047032) at Atlas Antibodies

Documents & Links for Anti TRMT6 pAb (ATL-HPA047032)
Datasheet Anti TRMT6 pAb (ATL-HPA047032) Datasheet (External Link)
Vendor Page Anti TRMT6 pAb (ATL-HPA047032)