Anti TRMT44 pAb (ATL-HPA045461)

Atlas Antibodies

SKU: ATL-HPA045461-25

• 
• 

Protein Description: tRNA methyltransferase 44 homolog (S. cerevisiae)
Gene Name: TRMT44
Alternative Gene Name: C4orf23, FLJ35725, METTL19, TRM44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029097: 73%, ENSRNOG00000008898: 72%
Entrez Gene ID: 152992
Uniprot ID: Q8IYL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAEL
• Gene Sequence: ETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAEL
• Gene ID - Mouse: ENSMUSG00000029097
• Gene ID - Rat: ENSRNOG00000008898
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.