Protein Description: tripartite motif containing 65
Gene Name: TRIM65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054517: 51%, ENSRNOG00000024145: 47%
Entrez Gene ID: 201292
Uniprot ID: Q6PJ69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRIM65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054517: 51%, ENSRNOG00000024145: 47%
Entrez Gene ID: 201292
Uniprot ID: Q6PJ69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IEVAKTQALAQARDEEQRLRVHLEAVARHGCRIRELLEQVDEQTFLQESQLLQPPGPLGPLTPLQWDEDQQLGDLKQLLSRLCGLLLEEGSHPGAPAKPVDLA |
Documents & Links for Anti TRIM65 pAb (ATL-HPA064820) | |
Datasheet | Anti TRIM65 pAb (ATL-HPA064820) Datasheet (External Link) |
Vendor Page | Anti TRIM65 pAb (ATL-HPA064820) at Atlas |
Documents & Links for Anti TRIM65 pAb (ATL-HPA064820) | |
Datasheet | Anti TRIM65 pAb (ATL-HPA064820) Datasheet (External Link) |
Vendor Page | Anti TRIM65 pAb (ATL-HPA064820) |