Anti TRIM65 pAb (ATL-HPA021575)

Atlas Antibodies

SKU: ATL-HPA021575-25

• 
• 

Protein Description: tripartite motif containing 65
Gene Name: TRIM65
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054517: 74%, ENSRNOG00000024145: 73%
Entrez Gene ID: 201292
Uniprot ID: Q6PJ69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFWLLEGRTLTLCHQPGAVFPLG
• Gene Sequence: WHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFWLLEGRTLTLCHQPGAVFPLG
• Gene ID - Mouse: ENSMUSG00000054517
• Gene ID - Rat: ENSRNOG00000024145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TRIM65 pAb (ATL-HPA021575) – 1 Found

Chen, Daici; Li, Yichen; Zhang, Xiaowen; Wu, Haiyong; Wang, Qian; Cai, Jian; Cui, Yanmei; Liu, Huanliang; Lan, Ping; Wang, Jianping; Yang, Zihuan; Wang, Lei. Ubiquitin ligase TRIM65 promotes colorectal cancer metastasis by targeting ARHGAP35 for protein degradation. Oncogene. 2019;38(37):6429-6444.