Anti TRIM55 pAb (ATL-HPA053691)

Atlas Antibodies

SKU: ATL-HPA053691-25

• 
• 

Protein Description: tripartite motif containing 55
Gene Name: TRIM55
Alternative Gene Name: MURF-2, RNF29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060913: 91%, ENSRNOG00000012723: 90%
Entrez Gene ID: 84675
Uniprot ID: Q9BYV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK
• Gene Sequence: SNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIK
• Gene ID - Mouse: ENSMUSG00000060913
• Gene ID - Rat: ENSRNOG00000012723
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.